The domain within your query sequence starts at position 230 and ends at position 318; the E-value for the Thr_synth_N domain shown below is 3.2e-16.

TFISTRHVCLKDHDKKFPPKYFSEAVVEGLASDGGLFVPEKEFPKLSPGEWNNLIGATYI
ERAQVLLERCIHPADIPAAKLGEMIETAY

Thr_synth_N

Thr_synth_N
PFAM accession number:PF14821
Interpro abstract (IPR029144):

This domain is found at the N terminus of many threonine synthase enzymes [(PUBMED:11756443)]. Threonine synthases catalyses the gamma-elimination of phosphate from L-phosphohomoserine and the beta-addition of water to produce L-threonine [(PUBMED:8074505)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thr_synth_N