The domain within your query sequence starts at position 412 and ends at position 454; the E-value for the Titin_Z domain shown below is 7.7e-16.

TKEVKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTT

Titin_Z

Titin_Z
PFAM accession number:PF09042
Interpro abstract (IPR015129):

This entry represents the Z-repeat (approximately 45 amino acid sequences) found in the N terminus of titin [(PUBMED:10819994)]. The Z-repeat recognises and binds to the C-terminal calmodulin-like domain of alpha-actinin-2 (Act-EF34). It adopts a helical structure, and binds in a groove formed by the two planes between the helix pairs of Act-EF34. This interaction is essential for sarcomere assembly [(PUBMED:11573089)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Titin_Z