The domain within your query sequence starts at position 2 and ends at position 96; the E-value for the Tmemb_14 domain shown below is 3.4e-30.

DLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTAF
FLATIMGVRFKRSKKVMPAGLVAGLSLMMILRLVL

Tmemb_14

Tmemb_14
PFAM accession number:PF03647
Interpro abstract (IPR005349):

This entry includes a group of transmembrane proteins, including protein FATTY ACID EXPORT 1 (FAX1) from Arabidopsis and TMEM14 from animals. FAX1 mediates the export of free fatty acid from the plastids and is required for biogenesis of the outer pollen cell wall, in particular for the assembly of exine and pollen coat and for the release of ketone wax components [(PUBMED:25646734)]. The Zebrafish TMEM14 is required for normal heme biosynthesis [(PUBMED:19656490)].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_14