The domain within your query sequence starts at position 5 and ends at position 122; the E-value for the Tmemb_18A domain shown below is 1.6e-61.

EQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSL
WNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRP

Tmemb_18A

Tmemb_18A
PFAM accession number:PF09771
Interpro abstract (IPR019168):

Nuclear envelope phosphatase 1-regulatory subunit 1 (NEP1-R1), formerly known as TMEM188, functions in the lipin activation pathway [ (PUBMED:22134922) ]. NEP1R1 forms a complex with the phosphatase CTDNEP1. The complex dephosphorylates and may activate phosphatidate phosphatases Lipin-1 and -2, which catalyse the conversion of phosphatidic acid to diacylglycerol.

GO process:positive regulation of protein dephosphorylation (GO:0035307)
GO component:Nem1-Spo7 phosphatase complex (GO:0071595)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_18A