The domain within your query sequence starts at position 32 and ends at position 162; the E-value for the Tmemb_40 domain shown below is 6.5e-57.

YEDIGSSRVRYWDLLLLIPNVLFFIFLLWKLPLARAKIRVTSSPIFITFYILVFVVALVG
IARAVVSMTVSASDAATVADKILWEITRFFLLAIELSVIILGLAFGHLESKSSIKRVLAI
TTVLSLAYSVT

Tmemb_40

Tmemb_40
PFAM accession number:PF10160
Interpro abstract (IPR018781):

This family of membrane proteins are conserved from plants to humans, including CAND2 and CAND8 from Arabidopsis. CAND2 and CAND8 are predicted G-protein coupled receptors [ (PUBMED:18671868) ]. CAND2 plays a role in plants and microbes interactions [ (PUBMED:22206669) ] and acts as a phytomelatonin receptor that regulates stomatal closure through the Galpha subunit-mediated H2O2 production and Ca2 flux dynamics [ (PUBMED:29702752) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_40