The domain within your query sequence starts at position 36 and ends at position 311; the E-value for the Tmemb_40 domain shown below is 9.9e-95.

GSSRVRYWDLLLLIPNVLFFIFLLWKLPLARAKIRVTSSPIFITFYILVFVVALVGIARA
VVSMTVSASDAATVADKILWEITRFFLLAIELSVIILGLAFGHLESKSSIKRVLAITTVL
SLAYSVTQGTLEILYPDSHLSAEDFNIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKE
RVSLPSRRSFYVYAGILATLNLLQGLGSALLCANIIVGLCCVDATTFLYFSFFAPLIYVA
FLRGFFGSEPKILFSYKCQVDEAEEPDMHLPQPYAV

Tmemb_40

Tmemb_40
PFAM accession number:PF10160
Interpro abstract (IPR018781):

This family of proteins are conserved from plants to humans. They are predicted to be membrane proteins, but apart from that their function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_40