The domain within your query sequence starts at position 99 and ends at position 134; the E-value for the Tmp39 domain shown below is 1.7e-18.

SDKWNHTLSMALILFCNYYVLFKLLRDRIVLGRAYS

Tmp39

• PFAM accession number: PF10271
• Interpro abstract (IPR019397):

  This is a family of putative, eukaryote, transmembrane proteins but the function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmp39