The domain within your query sequence starts at position 869 and ends at position 943; the E-value for the TolA_bind_tri domain shown below is 4e-11.

HEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVS
LEEHSRRMSTVSQSL

TolA_bind_tri

TolA_bind_tri
PFAM accession number:PF16331
Interpro abstract (IPR032519):

This is the N-terminal domain of the YbgF protein. YbgF binds to TolA. This domain mediates trimerisation [(PUBMED:20816983)].

GO process:protein trimerization (GO:0070206)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TolA_bind_tri