The domain within your query sequence starts at position 869 and ends at position 943; the E-value for the TolA_bind_tri domain shown below is 4e-11.
HEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVS LEEHSRRMSTVSQSL
TolA_bind_tri |
---|
PFAM accession number: | PF16331 |
---|---|
Interpro abstract (IPR032519): | This is the N-terminal domain of the YbgF protein. YbgF binds to TolA. This domain mediates trimerisation [ (PUBMED:20816983) ]. |
GO process: | protein trimerization (GO:0070206) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TolA_bind_tri