The domain within your query sequence starts at position 9 and ends at position 121; the E-value for the Tom22 domain shown below is 1.8e-16.
GAGEPLSPEELLPKAEAEKAEEELEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFD LSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILL
Tom22 |
---|
PFAM accession number: | PF04281 |
---|---|
Interpro abstract (IPR005683): | The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins [ (PUBMED:11866524) ]. The N-terminal region of Tom22 has been shown to have chaperone-like activity, and the C-terminal region faces the intermembrane face [ (PUBMED:14699115) ]. |
GO process: | intracellular protein transport (GO:0006886) |
GO component: | mitochondrial outer membrane (GO:0005741) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tom22