The domain within your query sequence starts at position 2630 and ends at position 2708; the E-value for the Tox-GHH domain shown below is 3.2e-35.

ARAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQ
FLRQSEIGKR

Tox-GHH

Tox-GHH
PFAM accession number:PF15636
Interpro abstract (IPR028916):

This entry represents the HNH/Endonuclease VII fold present in bacterial polymorphic toxin systems with a characteristic sG[HQ]H signature motif. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 6, type 7 or TcdB/TcaC-type secretion system [(PUBMED:22731697)].

In animals, an inactive version of the GHH domain can be found in the C-terminal of teneurin and Odd Oz proteins [(PUBMED:22731697)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tox-GHH