The domain within your query sequence starts at position 128 and ends at position 276; the E-value for the Transcrip_act domain shown below is 9.3e-11.

KPDCKVEKKKMELQEKSRWEVLQQEQRLMEEKNKRKKALLAQAIAERSKKTQAETIKLKR
IQKELQALDDMVSADIGILRNRIDQASLEYSYARKRFDRAEAEYITAKLDLQRKTETKEQ
LTEHLCTIIQQNELRKAKKLEELMQQLDV

Transcrip_act

Transcrip_act
PFAM accession number:PF04949
Interpro abstract (IPR007033):

This entry represents RAB6-interacting golgin, including SCYL1BP1 (also known as GORAB) from humans. SCYL1BP1 localises to the Golgi apparatus and interacts with Rab6 [(PUBMED:18997784), (PUBMED:26000619)]. Therefore, SCYL1BP1 is identified as a golgin, a protein that tether vesicles to the Golgi apparatus.

This entry also includes plant proteins, such as TaSRG (F4MH09) from wheat. TaSRG plays a role in stress response in plants [(PUBMED:21457711)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transcrip_act