The domain within your query sequence starts at position 47 and ends at position 165; the E-value for the Transglut_N domain shown below is 9e-34.
NVTAVHLFKERWDSNKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVI GRYPQENKGTYIPVPVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVW
Transglut_N |
---|
PFAM accession number: | PF00868 |
---|---|
Interpro abstract (IPR001102): | Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase Protein-glutamine gamma-glutamyltransferases ( EC 2.3.2.13 ) (TGase) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [ (PUBMED:1683845) (PUBMED:1974250) ]. Transglutaminases are widely distributed in various organs, tissues and body fluids. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. There are commonly three domains: N-terminal, middle ( IPR013808 ) and C-terminal ( IPR008958 ). This entry represents the N-terminal domain found in transglutaminases. |
GO process: | peptide cross-linking (GO:0018149) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transglut_N