The domain within your query sequence starts at position 8 and ends at position 118; the E-value for the Transglut_N domain shown below is 4e-26.

IIYAVNVERKLNAAAHHTSEYQTKKLVLRRGQIFTLKVILNRPLQPQDELKVTFTSGQRD
PPYMVELDPVTSYRSKGWQVKIAKQSGVEVILNVISAADAVVGRYKMRVNE

Transglut_N

Transglut_N
PFAM accession number:PF00868
Interpro abstract (IPR001102): Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase

Protein-glutamine gamma-glutamyltransferases (EC 2.3.2.13) (TGase) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [(PUBMED:1683845), (PUBMED:1974250)].

Transglutaminases are widely distributed in various organs, tissues and body fluids. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot.

There are commonly three domains: N-terminal, middle (IPR013808) and C-terminal (IPR008958). This entry represents the N-terminal domain found in transglutaminases.

GO process:peptide cross-linking (GO:0018149)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transglut_N