SMART: Pfam domain Transglut

The domain within your query sequence starts at position 215 and ends at position 390; the E-value for the Transglut_core2 domain shown below is 3e-43.

RDIQAQIHSIVELVCKTLRGINSRHPSLTFRAGESSMIMEIELQSQVLDAINYVLYDQLK
FKGNRMDYYNALNLYMHQVLTRRTGIPISMSLLYLTVARQLGVPLEPVNFPSHFLLRWCQ
GAEGATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVG

Transglut_core2

PFAM accession number:	PF13369
Interpro abstract (IPR032698):	This domain can be found in the N terminus of the bacterial SirB1 protein. It can also be found in the mammalian F-box only protein 21 (FBXO21). SirB is required for maximal expression of sirC, which encodes an SPI1-encoded transcription factor [ (PUBMED:10322010) ]. FBXO21 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex [ (PUBMED:26085330) ].

PFAM accession number:

PF13369

Interpro abstract (IPR032698):

This domain can be found in the N terminus of the bacterial SirB1 protein. It can also be found in the mammalian F-box only protein 21 (FBXO21).

SirB is required for maximal expression of sirC, which encodes an SPI1-encoded transcription factor [ (PUBMED:10322010) ].

FBXO21 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex [ (PUBMED:26085330) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transglut_core2