The domain within your query sequence starts at position 495 and ends at position 617; the E-value for the Transketolase_C domain shown below is 3.4e-30.
GQAKVIRQSAVDKVTVIGAGVTLHEALVAAEELSQQGIFIRVIDLFTIKPLDAVTIIQSA KATGGQIITVEDHYREGGIGEAVCAAISREPDIVVRQLAVTEVPRSGKPSELLDMFGISA RHI
Transketolase_C |
---|
PFAM accession number: | PF02780 |
---|---|
Interpro abstract (IPR033248): | The C-terminal domain of transketolase has been proposed as a regulatory molecule binding site [ (PUBMED:8176731) (PUBMED:1628611) ]. Transketolase EC 2.2.1.1 (TK) catalyzes the reversible transfer of a two-carbon ketol unit from xylulose 5-phosphate to an aldose receptor, such as ribose 5-phosphate, to form sedoheptulose 7-phosphate and glyceraldehyde 3- phosphate. This enzyme, together with transaldolase, provides a link between the glycolytic and pentose-phosphate pathways. TK requires thiamine pyrophosphate as a cofactor. In most sources where TK has been purified, it is a homodimer of approximately 70kDa subunits. TK sequences from a variety of eukaryotic and prokaryotic sources [ (PUBMED:1567394) (PUBMED:1737042) ] show that the enzyme has been evolutionarily conserved. In the peroxisomes of methylotrophic yeast Pichia angusta (Yeast) (Hansenula polymorpha), there is a highly related enzyme, dihydroxy-acetone synthase (DHAS) EC 2.2.1.3 (also known as formaldehyde transketolase), which exhibits a very unusual specificity by including formaldehyde amongst its substrates. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transketolase_C