The domain within your query sequence starts at position 19 and ends at position 216; the E-value for the Translin domain shown below is 1.8e-59.

DIREEIRKVVQSLEQTAREILTLLQGVHQGTGFQDIPKRCLKAREHFSTVKTHLTSLKTK
FPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVE
DYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGL
KYDVKKVEEVVYDLSIRG

Translin

Translin
PFAM accession number:PF01997
Interpro abstract (IPR002848):

Translins are DNA-binding proteins that specifically recognise consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. They seem to recognise single-stranded DNA ends generated by staggered breaks occuring at recombination hot spots [(PUBMED:9013868)]. Translin folds into an alpha-alpha superhelix, consisting of two curved layers of alpha/alpha topology [(PUBMED:12079346), (PUBMED:15039555)].

This entry also includes translin-associated protein X (TRAX), which was found to interact with translin [(PUBMED:9013868), (PUBMED:12036294)].

GO function:sequence-specific DNA binding (GO:0043565)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Translin