The domain within your query sequence starts at position 51 and ends at position 264; the E-value for the Translin domain shown below is 4.2e-65.
DKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKILQVAQELSG EDMHQFHRAVTTGLQEYVEAVSFQHFIKTRSLISMEEINKQLTFTAEDSGKESKTPPAEG QEKQLVTWRLKLTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSF IGNTGPYEVSKKLYTLKQSLAKVENACYALKVRG
Translin |
---|
PFAM accession number: | PF01997 |
---|---|
Interpro abstract (IPR002848): | Translins are DNA-binding proteins that specifically recognise consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. They seem to recognise single-stranded DNA ends generated by staggered breaks occuring at recombination hot spots [ (PUBMED:9013868) ]. Translin folds into an alpha-alpha superhelix, consisting of two curved layers of alpha/alpha topology [ (PUBMED:12079346) (PUBMED:15039555) ]. This entry also includes translin-associated protein X (TRAX), which was found to interact with translin [ (PUBMED:9013868) (PUBMED:12036294) ]. |
GO function: | sequence-specific DNA binding (GO:0043565) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Translin