SMART: Pfam domain Translin

The domain within your query sequence starts at position 51 and ends at position 264; the E-value for the Translin domain shown below is 4.2e-65.

DKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKILQVAQELSG
EDMHQFHRAVTTGLQEYVEAVSFQHFIKTRSLISMEEINKQLTFTAEDSGKESKTPPAEG
QEKQLVTWRLKLTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSF
IGNTGPYEVSKKLYTLKQSLAKVENACYALKVRG

Translin

PFAM accession number:	PF01997
Interpro abstract (IPR002848):	Translins are DNA-binding proteins that specifically recognise consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. They seem to recognise single-stranded DNA ends generated by staggered breaks occuring at recombination hot spots [ (PUBMED:9013868) ]. Translin folds into an alpha-alpha superhelix, consisting of two curved layers of alpha/alpha topology [ (PUBMED:12079346) (PUBMED:15039555) ]. This entry also includes translin-associated protein X (TRAX), which was found to interact with translin [ (PUBMED:9013868) (PUBMED:12036294) ].
GO function:	sequence-specific DNA binding (GO:0043565)

PFAM accession number:

PF01997

Interpro abstract (IPR002848):

Translins are DNA-binding proteins that specifically recognise consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. They seem to recognise single-stranded DNA ends generated by staggered breaks occuring at recombination hot spots [ (PUBMED:9013868) ]. Translin folds into an alpha-alpha superhelix, consisting of two curved layers of alpha/alpha topology [ (PUBMED:12079346) (PUBMED:15039555) ].

This entry also includes translin-associated protein X (TRAX), which was found to interact with translin [ (PUBMED:9013868) (PUBMED:12036294) ].

GO function:

sequence-specific DNA binding (GO:0043565)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Translin