The domain within your query sequence starts at position 1 and ends at position 109; the E-value for the Transmemb_17 domain shown below is 1e-30.
MLFHLSGLYSALYFLATLLMIVYKSQVFSYPCNCLALDLVLLLLMGILKVAQLYLGTKGN LMEAEVPLAASLAFTAVGGLLSVHFLLWQTLVLWMDSVLSTVLLVLHGL
Transmemb_17 |
---|
PFAM accession number: | PF09799 |
---|---|
Interpro abstract (IPR019184): | This entry represents a 100 amino acid region from a family of proteins that is predicted to be a transmembrane region but its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transmemb_17