The domain within your query sequence starts at position 495 and ends at position 782; the E-value for the Transposase_22 domain shown below is 2.2e-59.

SALSQVTPLLTNIEKGRYKVPQTEEPTAKEADLILETEENFKRGVISVIRQMQREVDKIK
NIYVSDVLNMKSSLDDLNSLACTIEARVSEQEDAVEGLTKDTMQLAREIVDKERLRERED
RFRSSNIRVIGIPEKENRENGAVDIIKEVIEENFAELEDQSLEIVSAHRVPNSVDEHRLT
PRHILVKFGSASDKQRVLKASRAKQEITYRGSKIRLTADLSPGTIDARSQWCGIIKILQD
EGFQPRILYPAKLAFDFKGKTKIFFDIEEFKKFISDIPYLKDLLNNIH

Transposase_22

Transposase_22
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transposase_22