The domain within your query sequence starts at position 28 and ends at position 70; the E-value for the Trefoil domain shown below is 3.6e-12.
CPVLSELERINCIPDQSSNKGTCDERGCCWDPQGSISVPCYYS
Trefoil |
---|
PFAM accession number: | PF00088 |
---|---|
Interpro abstract (IPR000519): | A cysteine-rich domain of approximately forty five amino-acid residues has been found in some extracellular eukaryotic proteins [ (PUBMED:7820556) (PUBMED:9187350) (PUBMED:8518738) (PUBMED:8267796) ]. It is known as either the 'P', 'trefoil' or 'TFF' domain, and contains six cysteines linked by three disulphide bonds with connectivity 1-5, 2-4, 3-6. This leads to a characteristic three leafed structure ('trefoil'). The P-type domain is clearly composed of three looplike regions. The central core of the domain consists of a short two-stranded antiparallel beta-sheet, which is capped by an irregular loop and forms a central hairpin (loop 3). The beta-sheet is preceded by a short alpha-helix, with majority of the remainder of the domain contained in two loops, which lie on either side of the central hairpin. This domain has been found in a variety of extracellular eukaryotic proteins [ (PUBMED:7820556) (PUBMED:8518738) (PUBMED:8267796) ], including:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Trefoil