The domain within your query sequence starts at position 43 and ends at position 141; the E-value for the Trehalase domain shown below is 1.3e-21.

QLYQDDKQFVDMSLATSPDEVLQKFSELATVHNHSIPKEQLQEFVQSHFQPVGQELQSWT
PEDWKDSPQFLQKISDANLRVWAEELHKIWKKLGKKGLV

Trehalase

Trehalase
PFAM accession number:PF01204
Interpro abstract (IPR001661):

O-Glycosyl hydrolases (EC 3.2.1.) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [(PUBMED:7624375), (PUBMED:8535779)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.

Glycoside hydrolase family 37 comprises enzymes with only one known activity; trehalase (EC 3.2.1.28).

Trehalase is the enzyme responsible for the degradation of the disaccharide alpha,alpha-trehalose yielding two glucose subunits [(PUBMED:8444853)]. It is an enzyme found in a wide variety of organisms and whose sequence has been highly conserved throughout evolution.

GO process:trehalose metabolic process (GO:0005991)
GO function:alpha,alpha-trehalase activity (GO:0004555)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Trehalase