The domain within your query sequence starts at position 211 and ends at position 1005; the E-value for the Treslin_N domain shown below is < 1e-12.

LYWVDTTERSKLWASPDHVGYWTVCELLHHGGGTILPAETWSLGFTKARETVLPCGGELS
HKPHPSPWISALPIDATVNCLLYNSEYEASFPRIEGTLFLPVQGKEIEETWAISLEPLAM
HQRHFQKPVRIVLRGSVAQWSLPVSSALGTDSWMLQSPEEHRSTQRLLFQELVSRLTAEE
FHLVASVDPGEGWPPITGIISPFSANAMILTVFRAKEAEFQSHFLQTAATEGSQDTASLF
SDVVDSVLNQSHNLFEDPASSAPCVPEWVQQELSHTSSWSPALVEKWFPFSNASGATSDL
MESFWLLHAASPDNDESSKTESELTRCLSELYQRSHEESTVVNQERSRKKRGIPRTPVRQ
KMNTMSRSLKMLNVARLNVKAQKLHPDGSPDTAVEKGLQKAVIGRTADKLEDRGRILRSS
KLKEFKTEEELLAYIHDNYQKAVATEEITLYSCAQNMVSTIKMFLKSKDIKELEVACLSH
VNSNLLKTSKTLRQNLAGKMDTEDKVGECQLQVFLRLEMCEQCPSVLDRPDEVERIVEEV
TDLLRLVCLTKDSAYLSEFLEEILRLYIGSIPGTIGQLYHSLGLKIPQKLAGVLPTGFFS
DDSMSQESMSPPPSSSTHRSVSAITESEQLEELRTRSAKKRRKNALIRHKSIAEISQTLR
QIEVPKVSKRATRNENSHSASIQLPVPRKDTIQEVTKVRRNLFNQEMLSPSKRGLKKGLP
RSHSVSALECLHHKQDKFKKTKSSTFQGYCKLLTKSVAETPVHKQISRRLLHRQIKGRSS
DPGPDIHVVEESPEK

Treslin_N

Treslin_N
PFAM accession number:PF15292
Interpro abstract (IPR032746):

This entry represents the N terminus of treslin, a checkpoint regulator which plays a role in DNA replication preinitiation complex formation [(PUBMED:20116089), (PUBMED:20080954)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Treslin_N