The domain within your query sequence starts at position 170 and ends at position 325; the E-value for the TrkH domain shown below is 1.4e-9.

LGAFLAPLLAKLAWGTTTSAQNYTEPQSDRSALNQSFEATLDSVFAVPDDKNLLWTYASI
GTYVLVVSVFLFAPFFKKNSKQKKSEASAQGARRAKYHRALLCLLFLFFFFYVGAEVTYG
SFVFSFAITHVGMEESEAAGLNSIFWGTFAACRGLA

TrkH

 TrkH
PFAM accession number:PF02386
Interpro abstract (IPR003445):

This family consists of various potassium transport proteins (Trk) and V-type sodium ATP synthase subunit J or translocating ATPase J ( EC 3.6.1.34 ). These proteins are involved in active sodium up-take utilizing ATP in the process. TrkH from Escherichia coli is a hydrophobic membrane protein and determines the specificity and kinetics of cation transport by the TrK system in this organism [ (PUBMED:7896723) ]. This protein interacts with TrkA and requires TrkE for transport activity.

GO process:cation transport (GO:0006812), transmembrane transport (GO:0055085)
GO function:cation transmembrane transporter activity (GO:0008324)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TrkH