The domain within your query sequence starts at position 35 and ends at position 152; the E-value for the TrmE_N domain shown below is 4.1e-37.

TIFALSSGQGRCAIAVIRTSGPASGLALRSLTALQEPPPARRACLRLLRHPCSGEPLDRS
LVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGK

TrmE_N

TrmE_N
PFAM accession number:PF10396
Interpro abstract (IPR018948):

This family represents the shorter, B, chain of the homo-dimeric structure which is a guanine nucleotide-binding protein that binds and hydrolyses GTP. TrmE is homologous to the tetrahydrofolate-binding domain of N,N-dimethylglycine oxidase and indeed binds formyl-tetrahydrofolate. TrmE actively participates in the formylation reaction of uridine and regulates the ensuing hydrogenation reaction of a Schiff's base intermediate. This B chain is the N-terminal portion of the protein consisting of five beta-strands and three alpha helices and is necessary for mediating dimer formation within the protein [(PUBMED:15616586)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TrmE_N