The domain within your query sequence starts at position 26 and ends at position 372; the E-value for the Trp_dioxygenase domain shown below is 8e-177.

DRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQ
ILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFRE
YLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLV
EAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLL
CLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWR
YNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYL

Trp_dioxygenase

Trp_dioxygenase
PFAM accession number:PF03301
Interpro abstract (IPR004981):

This is a family of tryptophan 2,3-dioxygenase (EC 1.13.11.11) enzymes involved in tryptophan metabolism, which catalyses the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring [(PUBMED:17212352)].

GO process:tryptophan catabolic process to kynurenine (GO:0019441)
GO function:tryptophan 2,3-dioxygenase activity (GO:0004833), heme binding (GO:0020037)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Trp_dioxygenase