The domain within your query sequence starts at position 85 and ends at position 221; the E-value for the Tsg domain shown below is 3.6e-49.
PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHH QNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCM
Tsg |
---|
PFAM accession number: | PF04668 |
---|---|
Interpro abstract (IPR006761): | Tsg was identified in Drosophila melanogaster as being required to specify the dorsal-most structures in the embryo, for example the amnioserosa. Biochemical experiments have revealed three key properties of Tsg:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tsg