The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the Tubulin domain shown below is 1.1e-22.
MGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVI DEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEII
Tubulin |
 |
|---|
| PFAM accession number: | PF00091 |
|---|---|
| Interpro abstract (IPR003008): | This entry represents a GTPase domain found in all tubulin chains, such as tubulin alpha, beta and gamma chains, and some bacterial FtsZ proteins [ (PUBMED:9628483) ]. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells [ (PUBMED:9144213) (PUBMED:9428770) ]. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings invitro and isubiquitous in bacteria and archaea. |
| GO function: | GTPase activity (GO:0003924) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tubulin