The domain within your query sequence starts at position 169 and ends at position 300; the E-value for the Tubulin domain shown below is 7.3e-9.

VHLHPRSICVIHKYHHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQ
LLCDLHDGFSGVGAKTAELLQDEYAGRGVLTWGLLPGPYSLGEPQKNIYRLLNTAFGLVH
LTGYSSFVCPLS

Tubulin

Tubulin
PFAM accession number:PF00091
Interpro abstract (IPR003008):

This entry represents a GTPase domain found in all tubulin chains, such as tubulin alpha, beta and gamma chains, and some bacterial FtsZ proteins [(PUBMED:9628483)]. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells [(PUBMED:9144213), (PUBMED:9428770)]. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings invitro and isubiquitous in bacteria and archaea.

GO function:GTPase activity (GO:0003924)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tubulin