The domain within your query sequence starts at position 11 and ends at position 53; the E-value for the Tudor-knot domain shown below is 8.9e-11.
FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKS
Tudor-knot |
---|
PFAM accession number: | PF11717 |
---|---|
Interpro abstract (IPR025995): | This is a novel knotted tudor domain which is required for binding to RNA. The knot influences the loop conformation of the helical turn Ht2 (residues 61-63) that is located at the side opposite the knot in the tudor domain-chromo domain; stabilisation of Ht2 is essential for RNA binding [ (PUBMED:18407291) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tudor-knot