The domain within your query sequence starts at position 25 and ends at position 430; the E-value for the Tweety domain shown below is 1.8e-182.

WEATSSQFRPEDADYQQALLLLGATALACLALDLLFLLFYSFWLCCRRRKTDEHLDADCC
CTAWCVIITTLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTAAALN
RTAEPNLQSLERQLAGRQEPLRAVQRLQTLLGTLLGYTAAIPFWRNPGVSLEVLAEQVDL
YDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILVGVCLLGVLALVISWGALGLELAVS
VGSSDFCVDPDTFVTKMVEEHSVLSGDILQYYLACSPRATNPFQQKLSGSHKALVEMQDV
VAELLRNVPREHPATKDPLLRVQEVLNGTEVNLQHLTALVDCRSLHLDYVQALTGFCYDG
VEGLIYLALFSFVTALMFSSIVCSIPHTWQQKRGPDDDGEEETAPG

Tweety

Tweety
PFAM accession number:PF04906
Interpro abstract (IPR006990):

The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C terminus. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins [(PUBMED:16219661), (PUBMED:18577513), (PUBMED:18260827), (PUBMED:17952139), (PUBMED:17116230), (PUBMED:15010458), (PUBMED:11597145), (PUBMED:10950931)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tweety