The domain within your query sequence starts at position 166 and ends at position 583; the E-value for the Tyr-DNA_phospho domain shown below is 2.4e-142.

QFYLTRVSGIKAKYNSKALHIKDILSPLFGTLVSSAQFNYCFDVDWLIKQYPPEFRKNPI
LLVHGDKREAKADLHAQAKPYANISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNL
IREDWHQKTQGIWLSPLYPRIDQGSHTAGESSTRFKADLTSYLTAYNAPPLQEWIDIIQE
HDLSETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQFSSIGSL
GPDESKWLCSEFKDSLLALREEGRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSI
QTAEKQRWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKLAWFLVTSANLSKAAWGA
LEKNGTQLMIRSYELGVLFLPSAFGLDTFKVKQKFFSSSCEPTASFPVPYDLPPELYG

Tyr-DNA_phospho

Tyr-DNA_phospho
PFAM accession number:PF06087
Interpro abstract (IPR010347):

Tyrosyl-DNA phosphodiesterase 1 (Tdp1) is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate [(PUBMED:12023295), (PUBMED:19505854)].

Mutations in human TDP1 gene cause spinocerebellar ataxia, autosomal recessive, with axonal neuropathy (SCAN1), which is a clinically and genetically heterogeneous group of cerebellar disorders [(PUBMED:16141202)].

GO process:DNA repair (GO:0006281)
GO component:nucleus (GO:0005634)
GO function:phosphoric diester hydrolase activity (GO:0008081)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tyr-DNA_phospho