The domain within your query sequence starts at position 238 and ends at position 354; the E-value for the U3snoRNP10 domain shown below is 7e-30.

VVAKLFPYIQKGLKSSLPDYRAATYMIICQISVKVTMEDTFVKSLASQLIKTLTKVPSQV
NDGLGCLIILLQRQKPENLGEKPFLHLCGVPDLIGLLHGISESYDVSPLLRCMLPHL

U3snoRNP10

U3snoRNP10
PFAM accession number:PF12397
Interpro abstract (IPR022125):

This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with. This family is the protein associated with U3 snoRNA which is involved in the processing of pre-rRNA.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry U3snoRNP10