The domain within your query sequence starts at position 1208 and ends at position 1343; the E-value for the U5_2-snRNA_bdg domain shown below is 1.9e-73.

THKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTAL
IGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGM
LSMGHVLIPQSDLRWS

U5_2-snRNA_bdg

U5_2-snRNA_bdg
PFAM accession number:PF10597
Interpro abstract (IPR019581):

The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis [(PUBMED:16431982)]. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor [(PUBMED:16431982)].

GO function:U5 snRNA binding (GO:0030623)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry U5_2-snRNA_bdg