The domain within your query sequence starts at position 13 and ends at position 313; the E-value for the UAA domain shown below is 2.1e-58.

ELSPSPPVPLPALNGSSADSSVRLMAASRSLVPDRLRLPLCFLGVFVCYFYYGILQEKIT
RGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARVDRTRTWLYAACSVSYVG
AMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMY
KPKKVVGIEEHTVGFGELLLLMSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTFLL
GAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTR
K

UAA

UAA
PFAM accession number:PF08449
Interpro abstract (IPR013657):

This family includes transporters with a specificity for UDP-N-acetylglucosamine [(PUBMED:11432728)].

GO process:transmembrane transport (GO:0055085)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UAA