The domain within your query sequence starts at position 353 and ends at position 573; the E-value for the UBN_AB domain shown below is 2.4e-80.

FPEGLPIPLEKRVKELAQAARAAEGESKQKFFTQDINGILLDIEVQTRELTSQIRSGVFA
YLASFLPCSKDALVKRARKLHLYEQGGRLKEPLQKLKDAIGRAMPEQVAKYQDECQAHTQ
AKVAKMLEEEKDKEQRERICSDEEEDEEKGGRRIMGPRKKFQWNDEIRELLCQVVKIKLE
SRDLERNSKAQAWEDCVKAFLDAEVKPLWPKGWMQARTLFK

UBN_AB

UBN_AB
PFAM accession number:PF14075
Interpro abstract (IPR026947):

Ubinuclein 1 and 2 (UBN1, UBN2) are members of a histone chaperone complex involved in the formation of a certain type of facultative heterochromatin, called senescence-associated heterochromatin foci (SAHF) [(PUBMED:19029251), (PUBMED:19225618)]. The domain described here is conserved in many eukaryotes such as human, rat, drosophila, and zebra-fish.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBN_AB