The domain within your query sequence starts at position 337 and ends at position 422; the E-value for the UBX domain shown below is 4.7e-9.
PDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCV PSEEWPNPPTLQEAGLSHTEVLFVQD
UBX |
 |
|---|
| PFAM accession number: | PF00789 |
|---|---|
| Interpro abstract (IPR001012): | The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast. The function of the UBX domain is not known although the fragment of avian FAF-1 containing the UBX domain causes apoptosis of transfected cells. |
| GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBX