The domain within your query sequence starts at position 223 and ends at position 551; the E-value for the UCH domain shown below is 3.9e-45.

IVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRK
LWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKT
IVNDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKD
EKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFF
VEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGT
GKWYELQDLQVTDILPQMITLSEAYIQIW

UCH

UCH
PFAM accession number:PF00443
Interpro abstract (IPR001394):

Ubiquitin carboxyl-terminal hydrolases (UCH) (EC 3.1.2.12) [(PUBMED:1647207)] are thiol proteases that recognise and hydrolyse the peptide bond at the C-terminal glycine of ubiquitin. These enzymes are involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins. The deubiquitinsing proteases can be split into 2 size ranges, 20-30 kDa (IPR001578) and 100-200 kDa [(PUBMED:7845226)]: the second class consist of large proteins (800 to 2000 residues) that belong to the peptidase family C19, and this group is currently represented by yeast UBP1 [(PUBMED:2050695)].

UCH thiol proteases contain an N-terminal catalytic domain sometimes followed by C-terminal extensions that mediate protein-protein interactions [(PUBMED:23845989)]. This entry represents the catalytic domain of UCH proteins of the UBP1 group.

GO process:ubiquitin-dependent protein catabolic process (GO:0006511)
GO function:ubiquitinyl hydrolase activity (GO:0036459)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCH