The domain within your query sequence starts at position 172 and ends at position 470; the E-value for the UCH_1 domain shown below is 1.6e-25.

VGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESECK
AYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKVEEMSPELKNTVKSLFGGVITNNV
VSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEK
RACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGF
KDVGDRSKDTESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVK

UCH_1

UCH_1
PFAM accession number:PF13423
Interpro abstract (IPR028881): This entry represents a domain found in PAN2. The poly(A)-specific nuclease (PAN) is a deadenylating enzyme involved in cytoplasmic mRNA turnover. Both yeast and mammalian PAN have been shown to contain two subunits, PAN2 and PAN3; PAN2 is the catalytic subunit [(PUBMED:8550599)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCH_1