The domain within your query sequence starts at position 1 and ends at position 134; the E-value for the UCMA domain shown below is 2.9e-73.
MSWRRVILLSSLLALVLLCMLQEGTSASVGSRQAAAEGVQEGVKQKIFMQESDASNFLKR RGKRSPKSRDEVNAENRQRLRDDELRREYYEEQRNEFENFVEEQRDEQEERTREAVEQWR QWHYDGLYPSYLYN
UCMA |
---|
PFAM accession number: | PF17085 |
---|---|
Interpro abstract (IPR031386): | UCMA is a secreted cartilage-specific protein expressed predominantly in resting chondrocytes. It is secreted into the extracellular matrix as an uncleaved precursor and shows the same restricted distribution pattern in cartilage as UCMA mRNA. This protein is proteolytically processed and contains tyrosine sulfates. It seems to be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of foetal cartilage [ (PUBMED:18156182) ]. |
GO process: | regulation of osteoblast differentiation (GO:0045667) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCMA