The domain within your query sequence starts at position 80 and ends at position 145; the E-value for the UCR_TM domain shown below is 1.3e-33.

HTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSS
MSASAD

UCR_TM

UCR_TM
PFAM accession number:PF02921
Interpro abstract (IPR004192):

The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The bc1 complex contains 11 subunits, 3 respiratory subunits (cytochrome B, cytochrome C1, Rieske protein), 2 core proteins and 6 low-molecular weight proteins [(PUBMED:9651245)]. Each subunit of the cytochrome bc1 complex provides a single helix to make up the transmembrane region of the complex.

This entry represents the transmembrane domain of the iron-sulfur subunit Rieske.

GO process:oxidation-reduction process (GO:0055114)
GO function:ubiquinol-cytochrome-c reductase activity (GO:0008121)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UCR_TM