The domain within your query sequence starts at position 2 and ends at position 63; the E-value for the UDP-g_GGTase domain shown below is 9.4e-18.
GAWILKLREGKSEDIYEITGHEGAEPETNVGNVIVVLNTFKSKILKIQVKKKSGKIQEDV LA
UDP-g_GGTase |
 |
|---|
| PFAM accession number: | PF06427 |
|---|---|
| Interpro abstract (IPR009448): | The N-terminal region of this group of proteins is required for correct folding of the ER UDP-Glc: glucosyltransferase. These proteins selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. Unfolded, denatured glycoproteins are substantially better substrates for glucosylation by this enzyme than are the corresponding native proteins. This protein and transient glucosylation may be involved in monitoring and/or assisting the folding and assembly of newly made glycoproteins, in order to identify glycoproteins that need assistance in folding from chaperones |
| GO process: | protein glycosylation (GO:0006486) |
| GO function: | UDP-glucose:glycoprotein glucosyltransferase activity (GO:0003980) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UDP-g_GGTase