The domain within your query sequence starts at position 45 and ends at position 472; the E-value for the UDPGP domain shown below is 4.6e-90.

LNSFFRKAIGEFDRSSHQEKVDARMEPVPRQVLGSATRDQEQLQAWESEGLSQISQNKVA
VLLLAGGQGTRLGVSYPKGMYDVGLPSHKTLFQIQAERILKLQQLAEKHHGNKCTIPWYI
MTSGRTMESTKEFFTKHKFFGLKKENVVFFQQGMLPAMSFDGKIILEEKNKVSMAPDGNG
GLYRALAAQNIVEDMEQRGICSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVVEKTN
PTEPVGVVCRVDGVYQVVEYSEISLATAQRRSSDGRLLFNAGNIANHFFTVPFLKDVVNV
YEPQLQHHVAQKKIPYVDSQGHFIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFS
PLKNADSQNGKDNPTTARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSEAIT
ADVNHNLK

UDPGP

UDPGP
PFAM accession number:PF01704
Interpro abstract (IPR002618):

This family contains UTP--glucose-1-phosphate uridylyltransferases (EC 2.7.7.9), UDP-sugar pyrophosphorylases (EC 2.7.7.64), UDP-N-acetylglucosamine pyrophosphorylases (EC 2.7.7.23) and UDP-N-acetylhexosamine pyrophosphorylases, all of which catalyse the transfer of an uridylyl group.

GO process:metabolic process (GO:0008152)
GO function:uridylyltransferase activity (GO:0070569)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UDPGP