The domain within your query sequence starts at position 1 and ends at position 166; the E-value for the UDPGT domain shown below is 9.3e-98.
MPNMIFLGGINCKKKGKLTQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGR
IPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPM
VMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNK
UDPGT |
 |
---|
PFAM accession number: | PF00201 |
---|
Interpro abstract (IPR002213): |
UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule. This family currently consist of: - Mammalian UDP-glucuronosyl transferases (EC 2.4.1.17) (UDPGT) [(PUBMED:1909870)]. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens.
- A large number of putative UDPGT from Caenorhabditis elegans.
- Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [(PUBMED:7694285)] (EC 2.4.1.45) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system.
- Plants flavonol O(3)-glucosyltransferase (EC 2.4.1.91). An enzyme that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis.
- Baculoviruses ecdysteroid UDP-glucosyltransferase (EC 2.4.1) [(PUBMED:2505387)] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process.
- Prokaryotic zeaxanthin glucosyltransferase (EC 2.4.1) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside.
- Streptomyces macrolide glycosyltransferases (EC 2.4.1) [(PUBMED:8244027)]. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose.
|
GO process: | metabolic process (GO:0008152) |
GO function: | transferase activity, transferring hexosyl groups (GO:0016758) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UDPGT