The domain within your query sequence starts at position 4 and ends at position 91; the E-value for the UFC1 domain shown below is 2e-45.

EATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNSDNDWFRLESNKEGT
RWFGKCWYIHDFLKYEFDIEFEVSVIEW

UFC1

UFC1
PFAM accession number:PF08694
Interpro abstract (IPR014806):

Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes. Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme [ (PUBMED:15071506) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UFC1