The domain within your query sequence starts at position 18 and ends at position 194; the E-value for the UFD1 domain shown below is 2.1e-84.

RFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRM
THCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITN
PKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAP

UFD1

UFD1
PFAM accession number:PF03152
Interpro abstract (IPR004854):

This entry includes Ufd1 from fungi and Ufd1-like proteins from animals and plants.

Ufd1 is part of the Ufd1-Npl4 complex that functions as the substrate-recruiting cofactor for Cdc48 segregase. The Cdc48-Ufd1-Npl4 complex is involved in degradation of misfolded ER proteins [(PUBMED:20206597)]. The Ufd1-Npl4 complex has been found to recruit Cdc48 to ubiquitylated CMG (Cdc45-MCM-GINS) helicase at the end of chromosome replication, thereby driving the disassembly reaction [(PUBMED:28355556)].

In humans, Npl4-Ufd1 acts as a cofactor in reducing antiviral innate immune responses by facilitating proteasomal degradation of RIG-I (a viral RNA sensor) [(PUBMED:26471729)].

GO process:ubiquitin-dependent protein catabolic process (GO:0006511)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UFD1