The domain within your query sequence starts at position 11 and ends at position 168; the E-value for the UNC-93 domain shown below is 2.7e-16.

VSCGFLLLFTAYGGLQNLQSSLYSEQGLGVATLSTLYASVLLSSMFLPPILIKKCGCKWT
IVGSMCCYVVFSLGNFHANWYTLIPTSILLGLGAAPLWSAQGTYLTTMGNLQAEKVGKLG
KDVVNQYFGIFFLVFQSSGVWGNLISSLVFGKMSMQEA

UNC-93

UNC-93
PFAM accession number:PF05978
Interpro abstract (IPR010291):

The proteins in this family are represented by UNC-93 from Caenorhabditis elegans. UNC-93 colocalizes with SUP-10 and SUP-9 within muscle cells. Genetic studies suggest that these three proteins forms complex that coordinates muscle contraction. The function of UNC-93 is not known but is most likely an ion channel regulatory protein [(PUBMED:14534247)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC-93