The domain within your query sequence starts at position 3 and ends at position 201; the E-value for the UNC119_bdg domain shown below is 2.3e-119.

VDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLV
GFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQLDTGLARSSRLYKTRSRYYQPYEIPAV
NGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMNIKEPA
DTEVLQYQLQHLTLRGDRV

UNC119_bdg

UNC119_bdg
PFAM accession number:PF15435
Interpro abstract (IPR029219):

UNC119-binding protein family include human C5orf30 and its homologues from eukaryotes. C5orf30 may play a role in trafficking of proteins via its interaction with UNC119 and UNC119B cargo adapters. It may also play a role in ciliary membrane localisation [(PUBMED:22085962)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC119_bdg