SMART: Pfam domain UN

The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the UN_NPL4 domain shown below is 1.1e-36.

MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASS
SKSLHLLKIKHGDLLFLFPS

UN_NPL4

PFAM accession number:	PF11543
Interpro abstract (IPR024682):	Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway. Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert [ (PUBMED:17491009) ]. This entry represents the ubiquitin-like domain.

PFAM accession number:

PF11543

Interpro abstract (IPR024682):

Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway.

Npl4 has a N-terminal ubiquitin-like domain which has within its structure a beta-grasp fold with a helical insert [ (PUBMED:17491009) ]. This entry represents the ubiquitin-like domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UN_NPL4