The domain within your query sequence starts at position 705 and ends at position 782; the E-value for the UPAR_LY6 domain shown below is 1.4e-11.

CPMCVELFGSCKSTDSVTCPRGATHCYKGDIALQGGGLTTRVSIQGCMAPPIKPLLGDSK
TIGIFSAEESSNYRHEDD

UPAR_LY6

UPAR_LY6
PFAM accession number:PF00021
Interpro abstract (IPR016054): This entry represents a three-fold repeated domain in urokinase-type plasminogen activator receptor (uPAR) that occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2).

A variety of GPI-linked cell-surface glycoproteins are composed of one or more copies of a conserved domain of about 100 amino-acid residues [(PUBMED:1850423), (PUBMED:8394346)]. Among these proteins, U-PAR contains three tandem copies of the domain, while all the others are made up of a single domain.

As shown in the following schematic, this conserved domain contains 10 cysteine residues involved in five disulphide bonds - in U-PAR, the first copy of the domain lacks the fourth disulphide bond.


+------+ +------------------------+ +---+
| | | | | |
xCxxCxxxxxxCxxxxxCxxxxxCxxxxxxxxxxxxxxxxxxCxxxxCxxxxxxxxxxxxxxCCxxxCxxxxxxxx
| | | |
+---------------------+ +--------------+
'C': conserved cysteine involved in a disulphide bond.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPAR_LY6