The domain within your query sequence starts at position 24 and ends at position 141; the E-value for the UPF0020 domain shown below is 1.4e-11.

LLLEQYPTRPHIAACMLYTIHNTYDDIENKAVADLGCGCGVLSIGAAMLGAGLCVGFDID
EDALEIFNKNVEEFELTNVDMIQCDVYSLSNRMSKLFDTVIMNPPFGTKNNKAYSKES

UPF0020

UPF0020
PFAM accession number:PF01170
Interpro abstract (IPR000241): This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains [(PUBMED:11295541)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0020